Lineage for d1f15a_ (1f15 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163238Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 163239Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 163253Family b.10.1.2: Plant virus proteins [49616] (16 proteins)
  6. 163263Protein CMV coat protein [49645] (1 species)
  7. 163264Species Cucumber mosaic virus, strain fny [TaxId:12305] [49646] (1 PDB entry)
  8. 163265Domain d1f15a_: 1f15 A: [23320]

Details for d1f15a_

PDB Entry: 1f15 (more details), 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)

SCOP Domain Sequences for d1f15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f15a_ b.10.1.2 (A:) CMV coat protein {Cucumber mosaic virus, strain fny}
ercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdstv
wvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdmr
kyavlvyskddaletdelvlhvdiehqriptsgvlpv

SCOP Domain Coordinates for d1f15a_:

Click to download the PDB-style file with coordinates for d1f15a_.
(The format of our PDB-style files is described here.)

Timeline for d1f15a_: