SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f15a_ (1f15 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076015Family b.121.4.5: Bromoviridae-like VP [88639] (2 protein domains)
  6. 2076016Protein Cucumovirus coat protein [88640] (4 species)
  7. 2076051Species CMV (Cucumber mosaic virus), strain fny [TaxId:12305] [49646] (1 PDB entry)
  8. 2076052Domain d1f15a_: 1f15 A: [23320]

Details for d1f15a_

PDB Entry: 1f15 (more details), 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1f15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f15a_ b.121.4.5 (A:) Cucumovirus coat protein {CMV (Cucumber mosaic virus), strain fny [TaxId: 12305]}
ercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdstv
wvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdmr
kyavlvyskddaletdelvlhvdiehqriptsgvlpv

SCOPe Domain Coordinates for d1f15a_:

Click to download the PDB-style file with coordinates for d1f15a_.
(The format of our PDB-style files is described here.)

Timeline for d1f15a_: