Lineage for d3p0ba2 (3p0b A:413-517)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310510Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 2310589Family a.8.3.0: automated matches [233185] (1 protein)
    not a true family
  6. 2310590Protein automated matches [233187] (1 species)
    not a true protein
  7. 2310591Species Thermus thermophilus [TaxId:274] [233189] (1 PDB entry)
  8. 2310592Domain d3p0ba2: 3p0b A:413-517 [233191]
    Other proteins in same PDB: d3p0ba1, d3p0ba3
    automated match to d1ufaa1
    complexed with gol

Details for d3p0ba2

PDB Entry: 3p0b (more details), 1.35 Å

PDB Description: Thermus thermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed
PDB Compounds: (A:) TT1467 protein

SCOPe Domain Sequences for d3p0ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p0ba2 a.8.3.0 (A:413-517) automated matches {Thermus thermophilus [TaxId: 274]}
wlnektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaea
yareryeeharaffhllkgaspeelraleerdnpfpeadprlylf

SCOPe Domain Coordinates for d3p0ba2:

Click to download the PDB-style file with coordinates for d3p0ba2.
(The format of our PDB-style files is described here.)

Timeline for d3p0ba2: