Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) |
Family a.8.3.0: automated matches [233185] (1 protein) not a true family |
Protein automated matches [233187] (1 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [233189] (1 PDB entry) |
Domain d3p0ba2: 3p0b A:413-517 [233191] Other proteins in same PDB: d3p0ba1, d3p0ba3 automated match to d1ufaa1 complexed with gol |
PDB Entry: 3p0b (more details), 1.35 Å
SCOPe Domain Sequences for d3p0ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p0ba2 a.8.3.0 (A:413-517) automated matches {Thermus thermophilus [TaxId: 274]} wlnektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaea yareryeeharaffhllkgaspeelraleerdnpfpeadprlylf
Timeline for d3p0ba2: