SCOPe 2.03: Domain d3p0ba2: 3p0b A:413-517

Lineage for d3p0ba2 (3p0b A:413-517)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families)

5. Family a.8.3.0: automated matches [233185] (1 protein)
   not a true family

6. Protein automated matches [233187] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [233189] (1 PDB entry)

8. Domain d3p0ba2: 3p0b A:413-517 [233191]
   Other proteins in same PDB: d3p0ba1
   automated match to d1ufaa1
   complexed with gol

Details for d3p0ba2

PDB Entry: 3p0b, 1.35 Å

PDB Description: Thermus thermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed

PDB Compounds: (A:) TT1467 protein

SCOPe Domain Sequences for d3p0ba2:

Sequence; same for both SEQRES and ATOM records:

>d3p0ba2 a.8.3.0 (A:413-517) automated matches {Thermus thermophilus [TaxId: 274]}
wlnektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaea
yareryeeharaffhllkgaspeelraleerdnpfpeadprlylf

Timeline for d3p0ba2:

• d3p0ba2 is new in SCOPe 2.03-stable
  
• d3p0ba2 appears in SCOPe 2.04
  
• d3p0ba2 appears in the current release, SCOPe 2.08