Lineage for d1c8nb_ (1c8n B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431656Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2431662Protein Necrovirus coat protein [49637] (1 species)
  7. 2431663Species TNV (Tobacco necrosis virus) [TaxId:12054] [49638] (1 PDB entry)
  8. 2431665Domain d1c8nb_: 1c8n B: [23309]
    complexed with ca

Details for d1c8nb_

PDB Entry: 1c8n (more details), 2.25 Å

PDB Description: tobacco necrosis virus
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d1c8nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8nb_ b.121.4.7 (B:) Necrovirus coat protein {TNV (Tobacco necrosis virus) [TaxId: 12054]}
stvvsnselilnltpialaytvqslpliatqpawlgtiadnyskwrwvslriiyspkcpt
ttsgtvamclsydrndvapgsrvqlsqtykainfppyagydgaailntdvtptsaiyvdv
dvtrfdkawystigtaafaaltafdqnqfcpctvhigsdggpavavppgdiffkyvieli
epinptmnv

SCOPe Domain Coordinates for d1c8nb_:

Click to download the PDB-style file with coordinates for d1c8nb_.
(The format of our PDB-style files is described here.)

Timeline for d1c8nb_: