Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein Necrovirus coat protein [49637] (1 species) |
Species TNV (Tobacco necrosis virus) [TaxId:12054] [49638] (1 PDB entry) |
Domain d1c8na_: 1c8n A: [23308] complexed with ca |
PDB Entry: 1c8n (more details), 2.25 Å
SCOPe Domain Sequences for d1c8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8na_ b.121.4.7 (A:) Necrovirus coat protein {TNV (Tobacco necrosis virus) [TaxId: 12054]} nstvvsnselilnltpialaytvqslpliatqpawlgtiadnyskwrwvslriiyspkcp tttsgtvamclsydrndvapgsrvqlsqtykainfppyagydgaailntdvtptsaiyvd vdvtrfdkawystigtaafaaltafdqnqfcpctvhigsdggpavavppgdiffkyviel iepinptmn
Timeline for d1c8na_: