![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
![]() | Protein TNV coat protein [49637] (1 species) |
![]() | Species Tobacco necrosis virus [TaxId:12054] [49638] (1 PDB entry) |
![]() | Domain d1c8na_: 1c8n A: [23308] |
PDB Entry: 1c8n (more details), 2.25 Å
SCOP Domain Sequences for d1c8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8na_ b.10.1.2 (A:) TNV coat protein {Tobacco necrosis virus} nstvvsnselilnltpialaytvqslpliatqpawlgtiadnyskwrwvslriiyspkcp tttsgtvamclsydrndvapgsrvqlsqtykainfppyagydgaailntdvtptsaiyvd vdvtrfdkawystigtaafaaltafdqnqfcpctvhigsdggpavavppgdiffkyviel iepinptmn
Timeline for d1c8na_: