Lineage for d1c8nb_ (1c8n B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) 
Protein TNV coat protein [49637] (1 species) Species Tobacco necrosis virus [TaxId:12054] [49638] (1 PDB entry) 
Domain d1c8nb_: 1c8n B: [23309]
Details for d1c8nb_
PDB Entry: 1c8n (more details), 2.25 Å
PDB Description: tobacco necrosis virus
SCOP Domain Sequences for d1c8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8nb_ b.10.1.2 (B:) TNV coat protein {Tobacco necrosis virus}
stvvsnselilnltpialaytvqslpliatqpawlgtiadnyskwrwvslriiyspkcpt
ttsgtvamclsydrndvapgsrvqlsqtykainfppyagydgaailntdvtptsaiyvdv
dvtrfdkawystigtaafaaltafdqnqfcpctvhigsdggpavavppgdiffkyvieli
epinptmnv
SCOP Domain Coordinates for d1c8nb_:
Click to download the PDB-style file with coordinates for d1c8nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8nb_:
- d1c8nb_ appears in SCOP 1.57
- d1c8nb_ appears in the current release, SCOPe 2.08
View in 3D
