Lineage for d1cwpc_ (1cwp C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822292Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 2822293Protein Cucumovirus coat protein [88640] (4 species)
  7. 2822334Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry)
  8. 2822337Domain d1cwpc_: 1cwp C: [23307]
    protein/RNA complex

Details for d1cwpc_

PDB Entry: 1cwp (more details), 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1cwpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwpc_ b.121.4.5 (C:) Cucumovirus coat protein {Cowpea chlorotic mottle virus [TaxId: 12303]}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

SCOPe Domain Coordinates for d1cwpc_:

Click to download the PDB-style file with coordinates for d1cwpc_.
(The format of our PDB-style files is described here.)

Timeline for d1cwpc_: