Lineage for d1cwpc_ (1cwp C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11461Family b.10.1.2: Plant virus proteins [49616] (15 proteins)
  6. Protein Cowpea chlorotic mottle virus [49635] (1 species)
  7. Species Host: cowpea (Vigna unguiculta), (L.) [49636] (1 PDB entry)
  8. Domain d1cwpc_: 1cwp C: [23307]

Details for d1cwpc_

PDB Entry: 1cwp (more details), 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy

SCOP Domain Sequences for d1cwpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwpc_ b.10.1.2 (C:) Cowpea chlorotic mottle virus {Host: cowpea (Vigna unguiculta), (L.)}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

SCOP Domain Coordinates for d1cwpc_ are not available.

Timeline for d1cwpc_:

Domains from other chains:
(mouse over for more information)
d1cwpa_, d1cwpb_