Lineage for d1cwpb_ (1cwp B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141867Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 1141868Protein Cucumovirus coat protein [88640] (4 species)
  7. 1141907Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry)
  8. 1141909Domain d1cwpb_: 1cwp B: [23306]
    protein/RNA complex

Details for d1cwpb_

PDB Entry: 1cwp (more details), 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d1cwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwpb_ b.121.4.5 (B:) Cucumovirus coat protein {Cowpea chlorotic mottle virus [TaxId: 12303]}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

SCOPe Domain Coordinates for d1cwpb_:

Click to download the PDB-style file with coordinates for d1cwpb_.
(The format of our PDB-style files is described here.)

Timeline for d1cwpb_: