SCOP 1.55: Domain d1cwpb_: 1cwp B:

Lineage for d1cwpb_ (1cwp B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein Cowpea chlorotic mottle virus [49635] (1 species)
7. Species Host: cowpea (Vigna unguiculta), (L.) [49636] (1 PDB entry)
8. Domain d1cwpb_: 1cwp B: [23306]

Details for d1cwpb_

PDB Entry: 1cwp, 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy

SCOP Domain Sequences for d1cwpb_:

Sequence; same for both SEQRES and ATOM records:

>d1cwpb_ b.10.1.2 (B:) Cowpea chlorotic mottle virus {Host: cowpea (Vigna unguiculta), (L.)}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

SCOP Domain Coordinates for d1cwpb_ are not available.

Timeline for d1cwpb_:

• d1cwpb_ appears in SCOP 1.57
  
• d1cwpb_ appears in the current release, SCOPe 2.08