Lineage for d3nteb2 (3nte B:148-221)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487668Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1487669Protein automated matches [191156] (6 species)
    not a true protein
  7. 1487675Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (3 PDB entries)
  8. 1487677Domain d3nteb2: 3nte B:148-221 [233044]
    Other proteins in same PDB: d3ntea1, d3nteb1
    automated match to d1e6jp1
    complexed with fe, i3m, iod, na

Details for d3nteb2

PDB Entry: 3nte (more details), 1.95 Å

PDB Description: crystal structure of the wild-type full-length hiv-1 capsid protein
PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3nteb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nteb2 a.28.3.0 (B:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
aatleemmtacqgv

SCOPe Domain Coordinates for d3nteb2:

Click to download the PDB-style file with coordinates for d3nteb2.
(The format of our PDB-style files is described here.)

Timeline for d3nteb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nteb1