Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (6 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (3 PDB entries) |
Domain d3ntea2: 3nte A:148-221 [233046] Other proteins in same PDB: d3ntea1, d3nteb1 automated match to d1e6jp1 complexed with fe, i3m, iod, na |
PDB Entry: 3nte (more details), 1.95 Å
SCOPe Domain Sequences for d3ntea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntea2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp aatleemmtacqgv
Timeline for d3ntea2: