Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries) |
Domain d3imfd1: 3imf D:1-253 [232604] Other proteins in same PDB: d3imfa2, d3imfb2, d3imfc2, d3imfd2 automated match to d3ay7b_ complexed with act |
PDB Entry: 3imf (more details), 1.99 Å
SCOPe Domain Sequences for d3imfd1:
Sequence, based on SEQRES records: (download)
>d3imfd1 c.2.1.0 (D:1-253) automated matches {Bacillus anthracis [TaxId: 261594]} mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn aiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtc mtmdggqhlhqyp
>d3imfd1 c.2.1.0 (D:1-253) automated matches {Bacillus anthracis [TaxId: 261594]} mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn aiapgpiertggaemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdggq hlhqyp
Timeline for d3imfd1: