Lineage for d3imfa1 (3imf A:1-253)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094385Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 2094388Domain d3imfa1: 3imf A:1-253 [232601]
    Other proteins in same PDB: d3imfa2, d3imfb2, d3imfc2, d3imfd2
    automated match to d3ay7b_
    complexed with act

Details for d3imfa1

PDB Entry: 3imf (more details), 1.99 Å

PDB Description: 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d3imfa1:

Sequence, based on SEQRES records: (download)

>d3imfa1 c.2.1.0 (A:1-253) automated matches {Bacillus anthracis [TaxId: 261594]}
mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd
vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq
aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn
aiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtc
mtmdggqhlhqyp

Sequence, based on observed residues (ATOM records): (download)

>d3imfa1 c.2.1.0 (A:1-253) automated matches {Bacillus anthracis [TaxId: 261594]}
mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd
vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq
aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn
aiapgpiertggaemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdggq
hlhqyp

SCOPe Domain Coordinates for d3imfa1:

Click to download the PDB-style file with coordinates for d3imfa1.
(The format of our PDB-style files is described here.)

Timeline for d3imfa1: