![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries) |
![]() | Domain d3imfb1: 3imf B:1-253 [232603] Other proteins in same PDB: d3imfa2, d3imfb2, d3imfc2, d3imfd2 automated match to d3ay7b_ complexed with act |
PDB Entry: 3imf (more details), 1.99 Å
SCOPe Domain Sequences for d3imfb1:
Sequence, based on SEQRES records: (download)
>d3imfb1 c.2.1.0 (B:1-253) automated matches {Bacillus anthracis [TaxId: 261594]} mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn aiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtc mtmdggqhlhqyp
>d3imfb1 c.2.1.0 (B:1-253) automated matches {Bacillus anthracis [TaxId: 261594]} mkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqmd vrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycsq aigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirvn aiapgpiertggadeemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdg gqhlhqyp
Timeline for d3imfb1: