Lineage for d3i6tb1 (3i6t B:6-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555166Species Jannaschia sp. [TaxId:290400] [232554] (1 PDB entry)
  8. 2555168Domain d3i6tb1: 3i6t B:6-130 [232558]
    Other proteins in same PDB: d3i6ta2, d3i6tb2, d3i6tc2
    automated match to d2p8ba1
    complexed with k, mg

Details for d3i6tb1

PDB Entry: 3i6t (more details), 1.9 Å

PDB Description: crystal structure of muconate cycloisomerase from jannaschia sp.
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3i6tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6tb1 d.54.1.0 (B:6-130) automated matches {Jannaschia sp. [TaxId: 290400]}
qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve
atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw
allgg

SCOPe Domain Coordinates for d3i6tb1:

Click to download the PDB-style file with coordinates for d3i6tb1.
(The format of our PDB-style files is described here.)

Timeline for d3i6tb1: