Lineage for d3i6tc2 (3i6t C:131-369)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446141Species Jannaschia sp. [TaxId:290400] [232556] (1 PDB entry)
  8. 2446144Domain d3i6tc2: 3i6t C:131-369 [232561]
    Other proteins in same PDB: d3i6ta1, d3i6tb1, d3i6tc1, d3i6td1
    automated match to d2p8ba2
    complexed with k, mg

Details for d3i6tc2

PDB Entry: 3i6t (more details), 1.9 Å

PDB Description: crystal structure of muconate cycloisomerase from jannaschia sp.
PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3i6tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6tc2 c.1.11.0 (C:131-369) automated matches {Jannaschia sp. [TaxId: 290400]}
rcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpa
fdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesi
fgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagah
miaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav

SCOPe Domain Coordinates for d3i6tc2:

Click to download the PDB-style file with coordinates for d3i6tc2.
(The format of our PDB-style files is described here.)

Timeline for d3i6tc2: