Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Jannaschia sp. [TaxId:290400] [232554] (1 PDB entry) |
Domain d3i6tb1: 3i6t B:6-130 [232558] Other proteins in same PDB: d3i6ta2, d3i6tb2, d3i6tc2 automated match to d2p8ba1 complexed with k, mg |
PDB Entry: 3i6t (more details), 1.9 Å
SCOPe Domain Sequences for d3i6tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i6tb1 d.54.1.0 (B:6-130) automated matches {Jannaschia sp. [TaxId: 290400]} qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw allgg
Timeline for d3i6tb1: