Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (70 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [232454] (1 PDB entry) |
Domain d3hcwa1: 3hcw A:56-339 [232455] Other proteins in same PDB: d3hcwa2, d3hcwb2 automated match to d3k4ha_ complexed with gol |
PDB Entry: 3hcw (more details), 2.2 Å
SCOPe Domain Sequences for d3hcwa1:
Sequence, based on SEQRES records: (download)
>d3hcwa1 c.93.1.0 (A:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]} tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci dikprmlgqqagsailnilknkaqdvielviidtelkirkstqr
>d3hcwa1 c.93.1.0 (A:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]} tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci dikprmlgqqagsailnilkndvielviidtelkirkstqr
Timeline for d3hcwa1: