Lineage for d3hcwa1 (3hcw A:56-339)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144245Species Staphylococcus aureus [TaxId:158878] [232454] (1 PDB entry)
  8. 2144246Domain d3hcwa1: 3hcw A:56-339 [232455]
    Other proteins in same PDB: d3hcwa2, d3hcwb2
    automated match to d3k4ha_
    complexed with gol

Details for d3hcwa1

PDB Entry: 3hcw (more details), 2.2 Å

PDB Description: crystal structure of probable maltose operon transcriptional repressor malr from staphylococcus areus
PDB Compounds: (A:) Maltose operon transcriptional repressor

SCOPe Domain Sequences for d3hcwa1:

Sequence, based on SEQRES records: (download)

>d3hcwa1 c.93.1.0 (A:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilknkaqdvielviidtelkirkstqr

Sequence, based on observed residues (ATOM records): (download)

>d3hcwa1 c.93.1.0 (A:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilkndvielviidtelkirkstqr

SCOPe Domain Coordinates for d3hcwa1:

Click to download the PDB-style file with coordinates for d3hcwa1.
(The format of our PDB-style files is described here.)

Timeline for d3hcwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hcwa2