SCOPe 2.06: Domain d3hcwb1: 3hcw B:56-339

Lineage for d3hcwb1 (3hcw B:56-339)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [232454] (1 PDB entry)

8. Domain d3hcwb1: 3hcw B:56-339 [232456]
   Other proteins in same PDB: d3hcwa2, d3hcwb2
   automated match to d3k4ha_
   complexed with gol

Details for d3hcwb1

PDB Entry: 3hcw, 2.2 Å

PDB Description: crystal structure of probable maltose operon transcriptional repressor malr from staphylococcus areus

PDB Compounds: (B:) Maltose operon transcriptional repressor

SCOPe Domain Sequences for d3hcwb1:

Sequence, based on SEQRES records:

>d3hcwb1 c.93.1.0 (B:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilknkaqdvielviidtelkirkstqr

Sequence, based on observed residues (ATOM records):

>d3hcwb1 c.93.1.0 (B:56-339) automated matches {Staphylococcus aureus [TaxId: 158878]}
tnqtykiglvlkgseepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykm
ikqrmvdafillyskendpikqmlidesmpfivigkptsdidhqfthidndnilasenlt
rhvieqgvdelifitekgnfevskdriqgfetvasqfnldyqiietsnerevilnymqnl
htrlkdpnikqaiisldamlhlailsvlyelnieipkdvmtatfndsylteiasppqtci
dikprmlgqqagsailnilkndvielviidtelkirkstqr

Timeline for d3hcwb1:

• d3hcwb1 first appeared in SCOPe 2.03, called d3hcwb_
  
• d3hcwb1 was called d3hcwb_ in SCOPe 2.05
  
• d3hcwb1 appears in SCOPe 2.07
  
• d3hcwb1 appears in the current release, SCOPe 2.08