Lineage for d1d0ad1 (1d0a D:350-501)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11382Fold b.8: TRAF domain [49598] (1 superfamily)
  4. 11383Superfamily b.8.1: TRAF domain [49599] (1 family) (S)
  5. 11384Family b.8.1.1: TRAF domain [49600] (2 proteins)
  6. 11385Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 11386Species Human (Homo sapiens) [TaxId:9606] [49602] (9 PDB entries)
  8. 11401Domain d1d0ad1: 1d0a D:350-501 [23226]
    Other proteins in same PDB: d1d0aa2, d1d0ab2, d1d0ac2, d1d0ad2, d1d0ae2, d1d0af2

Details for d1d0ad1

PDB Entry: 1d0a (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 (traf2) in complex with a human ox40 peptide

SCOP Domain Sequences for d1d0ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ad1 b.8.1.1 (D:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOP Domain Coordinates for d1d0ad1:

Click to download the PDB-style file with coordinates for d1d0ad1.
(The format of our PDB-style files is described here.)

Timeline for d1d0ad1: