Lineage for d3g68b1 (3g68 B:1-350)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515715Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2515716Protein automated matches [190547] (16 species)
    not a true protein
  7. 2515767Species Clostridium difficile [TaxId:272563] [232242] (1 PDB entry)
  8. 2515769Domain d3g68b1: 3g68 B:1-350 [232244]
    Other proteins in same PDB: d3g68a2, d3g68b2
    automated match to d3knzf_
    complexed with cit, edo

Details for d3g68b1

PDB Entry: 3g68 (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphosugar isomerase (cd3275) from clostridium difficile 630 at 1.80 a resolution
PDB Compounds: (B:) putative phosphosugar isomerase

SCOPe Domain Sequences for d3g68b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g68b1 c.80.1.0 (B:1-350) automated matches {Clostridium difficile [TaxId: 272563]}
mtiqdymletpvrmreiisnadslfnevkrtnlkkiiitgsgtsyhsgvqvqpylqnlld
idvvkmypfmitedtfkfdnentlvvgvsqggssystynamklaedkgckiasmagckna
lideisdyiltvncgeeksgaktkgyyctklnlmllglqiarekgiissekyneeinkil
dainrfeavyklskqwiernkeklvnskeiriighsdiygdtleaalklletmripvtgy
efeefihgiynainsdstifildtgkeprvtkmidvlsgwtenvfaigrdvtendknlki
ditdnpyyqtfnfivpiqlicgeiptlrgvdpsvpkdtrfhmklgskkln

SCOPe Domain Coordinates for d3g68b1:

Click to download the PDB-style file with coordinates for d3g68b1.
(The format of our PDB-style files is described here.)

Timeline for d3g68b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g68b2