Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (13 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [232242] (1 PDB entry) |
Domain d3g68b_: 3g68 B: [232244] automated match to d3knzf_ complexed with cit, edo |
PDB Entry: 3g68 (more details), 1.8 Å
SCOPe Domain Sequences for d3g68b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g68b_ c.80.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]} gmtiqdymletpvrmreiisnadslfnevkrtnlkkiiitgsgtsyhsgvqvqpylqnll didvvkmypfmitedtfkfdnentlvvgvsqggssystynamklaedkgckiasmagckn alideisdyiltvncgeeksgaktkgyyctklnlmllglqiarekgiissekyneeinki ldainrfeavyklskqwiernkeklvnskeiriighsdiygdtleaalklletmripvtg yefeefihgiynainsdstifildtgkeprvtkmidvlsgwtenvfaigrdvtendknlk iditdnpyyqtfnfivpiqlicgeiptlrgvdpsvpkdtrfhmklgskkln
Timeline for d3g68b_: