Lineage for d3g39a_ (3g39 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1584080Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1584081Protein automated matches [190787] (7 species)
    not a true protein
  7. 1584124Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries)
  8. 1584125Domain d3g39a_: 3g39 A: [232232]
    automated match to d2o6ra_

Details for d3g39a_

PDB Entry: 3g39 (more details), 1.55 Å

PDB Description: Structure of a lamprey variable lymphocyte receptor
PDB Compounds: (A:) variable lymphocyte receptor VLRB.2D

SCOPe Domain Sequences for d3g39a_:

Sequence, based on SEQRES records: (download)

>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldl
dnnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdi
lylsrwisqhpglvfgylnldpdsarcsgtntpvravteastspskc

Sequence, based on observed residues (ATOM records): (download)

>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldld
nnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdil
ylsrwisqhpglvfgylnldpdsarcsgntpvravteastspskc

SCOPe Domain Coordinates for d3g39a_:

Click to download the PDB-style file with coordinates for d3g39a_.
(The format of our PDB-style files is described here.)

Timeline for d3g39a_: