Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (7 species) not a true protein |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries) |
Domain d3g39a_: 3g39 A: [232232] automated match to d2o6ra_ |
PDB Entry: 3g39 (more details), 1.55 Å
SCOPe Domain Sequences for d3g39a_:
Sequence, based on SEQRES records: (download)
>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} acpsqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldl dnnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdi lylsrwisqhpglvfgylnldpdsarcsgtntpvravteastspskc
>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} acpqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldld nnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdil ylsrwisqhpglvfgylnldpdsarcsgntpvravteastspskc
Timeline for d3g39a_: