SCOPe 2.05: Domain d3g39a_: 3g39 A:

Lineage for d3g39a_ (3g39 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (10 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries)

8. Domain d3g39a_: 3g39 A: [232232]
   automated match to d2o6ra_

Details for d3g39a_

PDB Entry: 3g39, 1.55 Å

PDB Description: Structure of a lamprey variable lymphocyte receptor

PDB Compounds: (A:) variable lymphocyte receptor VLRB.2D

SCOPe Domain Sequences for d3g39a_:

Sequence, based on SEQRES records:

>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldl
dnnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdi
lylsrwisqhpglvfgylnldpdsarcsgtntpvravteastspskc

Sequence, based on observed residues (ATOM records):

>d3g39a_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldld
nnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdil
ylsrwisqhpglvfgylnldpdsarcsgntpvravteastspskc

Timeline for d3g39a_:

• d3g39a_ first appeared in SCOPe 2.03
  
• d3g39a_ appears in SCOPe 2.04
  
• d3g39a_ appears in SCOPe 2.06
  
• d3g39a_ appears in the current release, SCOPe 2.08