Lineage for d2o6ra_ (2o6r A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1584080Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1584081Protein automated matches [190787] (7 species)
    not a true protein
  7. 1584107Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [193205] (2 PDB entries)
  8. 1584108Domain d2o6ra_: 2o6r A: [193206]
    automated match to d2wfha_

Details for d2o6ra_

PDB Entry: 2o6r (more details), 2.3 Å

PDB Description: Structural diversity of the hagfish Variable Lymphocyte Receptors B61
PDB Compounds: (A:) Variable lymphocyte receptor B

SCOPe Domain Sequences for d2o6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ra_ c.10.2.0 (A:) automated matches {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
cpsrcscsgteircnskgltsvptgipssatrlelesnklqslphgvfdkltqltklsls
qnqiqslpdgvfdkltkltilylhenklqslpngvfdkltqlkelaldtnqlksvpdgif
drltslqkiwlhtnpwdcscpridylsrwlnknsqkeqgsakcsgsgkpvrsiicpt

SCOPe Domain Coordinates for d2o6ra_:

Click to download the PDB-style file with coordinates for d2o6ra_.
(The format of our PDB-style files is described here.)

Timeline for d2o6ra_: