Lineage for d3fb3b1 (3fb3 B:1-143)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210068Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries)
  8. 2210072Domain d3fb3b1: 3fb3 B:1-143 [232154]
    Other proteins in same PDB: d3fb3b2
    automated match to d2fe7b_

Details for d3fb3b1

PDB Entry: 3fb3 (more details), 2.35 Å

PDB Description: crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
PDB Compounds: (B:) n-acetyltransferase

SCOPe Domain Sequences for d3fb3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fb3b1 d.108.1.0 (B:1-143) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchqptgriv
gsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcykvildss
ekslpfyeklgfraherqmrldl

SCOPe Domain Coordinates for d3fb3b1:

Click to download the PDB-style file with coordinates for d3fb3b1.
(The format of our PDB-style files is described here.)

Timeline for d3fb3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fb3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3fb3a_