SCOPe 2.05: Domain d3fb3b_: 3fb3 B:

Lineage for d3fb3b_ (3fb3 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (32 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries)

8. Domain d3fb3b_: 3fb3 B: [232154]
   automated match to d2fe7b_

Details for d3fb3b_

PDB Entry: 3fb3, 2.35 Å

PDB Description: crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886

PDB Compounds: (B:) n-acetyltransferase

SCOPe Domain Sequences for d3fb3b_:

Sequence; same for both SEQRES and ATOM records:

>d3fb3b_ d.108.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
nlyfqgvdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchq
ptgrivgsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcyk
vildssekslpfyeklgfraherqmrldl

Timeline for d3fb3b_:

• d3fb3b_ first appeared in SCOPe 2.03
  
• d3fb3b_ appears in SCOPe 2.04
  
• d3fb3b_ is called d3fb3b1 in SCOPe 2.06
  
• d3fb3b_ appears in the current release, SCOPe 2.08, called d3fb3b1