![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (28 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries) |
![]() | Domain d3fb3b_: 3fb3 B: [232154] automated match to d2fe7b_ |
PDB Entry: 3fb3 (more details), 2.35 Å
SCOPe Domain Sequences for d3fb3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fb3b_ d.108.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} nlyfqgvdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchq ptgrivgsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcyk vildssekslpfyeklgfraherqmrldl
Timeline for d3fb3b_: