SCOPe 2.08: Domain d3dgea1: 3dge A:245-320

Lineage for d3dgea1 (3dge A:245-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231990] (7 PDB entries)

8. Domain d3dgea1: 3dge A:245-320 [231992]
   Other proteins in same PDB: d3dgea2, d3dgeb2, d3dgec_, d3dged_
   automated match to d2c2aa1
   complexed with adp, cit, so4

Details for d3dgea1

PDB Entry: 3dge, 2.8 Å

PDB Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism

PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d3dgea1:

Sequence; same for both SEQRES and ATOM records:

>d3dgea1 a.30.2.0 (A:245-320) automated matches {Thermotoga maritima [TaxId: 2336]}
kridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlen
llnelldfsrlerksl

Timeline for d3dgea1:

• d3dgea1 first appeared in SCOPe 2.03
  
• d3dgea1 appears in SCOPe 2.07