SCOPe 2.08: Domain d3dgec_: 3dge C:

Lineage for d3dgec_ (3dge C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)

8. Domain d3dgec_: 3dge C: [173924]
   Other proteins in same PDB: d3dgea1, d3dgea2, d3dgeb1, d3dgeb2
   automated match to d1mvoa_
   complexed with adp, cit, so4

Details for d3dgec_

PDB Entry: 3dge, 2.8 Å

PDB Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism

PDB Compounds: (C:) Response regulator

SCOPe Domain Sequences for d3dgec_:

Sequence; same for both SEQRES and ATOM records:

>d3dgec_ c.23.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
ne

Timeline for d3dgec_:

• d3dgec_ first appeared in SCOPe 2.01
  
• d3dgec_ appears in SCOPe 2.07