![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) ![]() |
![]() | Family a.30.2.0: automated matches [227712] (1 protein) not a true family |
![]() | Protein automated matches [227713] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [231990] (7 PDB entries) |
![]() | Domain d3dgeb1: 3dge B:245-320 [231993] Other proteins in same PDB: d3dgea2, d3dgeb2, d3dgec_, d3dged_ automated match to d2c2aa1 complexed with adp, cit, so4 |
PDB Entry: 3dge (more details), 2.8 Å
SCOPe Domain Sequences for d3dgeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dgeb1 a.30.2.0 (B:245-320) automated matches {Thermotoga maritima [TaxId: 2336]} kridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlen llnelldfsrlerksl
Timeline for d3dgeb1:
![]() Domains from other chains: (mouse over for more information) d3dgea1, d3dgea2, d3dgec_, d3dged_ |