SCOPe 2.08: Domain d3d9wc_: 3d9w C:

Lineage for d3d9wc_ (3d9w C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Nocardia farcinica [TaxId:37329] [231965] (1 PDB entry)

8. Domain d3d9wc_: 3d9w C: [231967]
   automated match to d4guzd_

Details for d3d9wc_

PDB Entry: 3d9w, 2.7 Å

PDB Description: Crystal Structure Analysis of Nocardia farcinica Arylamine N-acetyltransferase

PDB Compounds: (C:) putative acetyltransferase

SCOPe Domain Sequences for d3d9wc_:

Sequence; same for both SEQRES and ATOM records:

>d3d9wc_ d.3.1.0 (C:) automated matches {Nocardia farcinica [TaxId: 37329]}
ddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvrl
dlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallrv
ttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfgr
dgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltliter
pdgsadiraltpgelpevinelfdielpgpdldalttgswle

Timeline for d3d9wc_:

• d3d9wc_ first appeared in SCOPe 2.03
  
• d3d9wc_ appears in SCOPe 2.07