PDB entry 3d9w

View 3d9w on RCSB PDB site
Description: Crystal Structure Analysis of Nocardia farcinica Arylamine N-acetyltransferase
Class: transferase
Keywords: ARYLAMINE N-ACETYLTRANSFERASE, TRANSFERASE, NAT, Acyltransferase
Deposited on 2008-05-28, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyltransferase
    Species: Nocardia farcinica [TaxId:37329]
    Gene: nfa18420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d9wa_
  • Chain 'B':
    Compound: putative acetyltransferase
    Species: Nocardia farcinica [TaxId:37329]
    Gene: nfa18420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d9wb_
  • Chain 'C':
    Compound: putative acetyltransferase
    Species: Nocardia farcinica [TaxId:37329]
    Gene: nfa18420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d9wc_
  • Chain 'D':
    Compound: putative acetyltransferase
    Species: Nocardia farcinica [TaxId:37329]
    Gene: nfa18420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d9wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d9wA (A:)
    mskpddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgr
    pvrldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpatha
    llrvttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlh
    qfgrdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltl
    iterpdgsadiraltpgelpevinelfdielpgpdldalttgswlervaagtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9wA (A:)
    pddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvr
    ldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallr
    vttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfg
    rdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltlite
    rpdgsadiraltpgelpevinelfdielpgpdldalttgswler
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d9wB (B:)
    mskpddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgr
    pvrldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpatha
    llrvttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlh
    qfgrdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltl
    iterpdgsadiraltpgelpevinelfdielpgpdldalttgswlervaagtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9wB (B:)
    ddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvrl
    dlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallrv
    ttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfgr
    dgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltliter
    pdgsadiraltpgelpevinelfdielpgpdldalttgswl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d9wC (C:)
    mskpddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgr
    pvrldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpatha
    llrvttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlh
    qfgrdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltl
    iterpdgsadiraltpgelpevinelfdielpgpdldalttgswlervaagtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9wC (C:)
    ddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvrl
    dlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallrv
    ttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfgr
    dgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltliter
    pdgsadiraltpgelpevinelfdielpgpdldalttgswle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d9wD (D:)
    mskpddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgr
    pvrldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpatha
    llrvttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlh
    qfgrdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltl
    iterpdgsadiraltpgelpevinelfdielpgpdldalttgswlervaagtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9wD (D:)
    ddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvrl
    dlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallrv
    ttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfgr
    dgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltliter
    pdgsadiraltpgelpevinelfdielpgpdldalttgswl