Lineage for d3d9wa_ (3d9w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927784Species Nocardia farcinica [TaxId:37329] [231965] (1 PDB entry)
  8. 2927785Domain d3d9wa_: 3d9w A: [231966]
    automated match to d4guzd_

Details for d3d9wa_

PDB Entry: 3d9w (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of Nocardia farcinica Arylamine N-acetyltransferase
PDB Compounds: (A:) putative acetyltransferase

SCOPe Domain Sequences for d3d9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9wa_ d.3.1.0 (A:) automated matches {Nocardia farcinica [TaxId: 37329]}
pddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvr
ldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallr
vttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfg
rdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltlite
rpdgsadiraltpgelpevinelfdielpgpdldalttgswler

SCOPe Domain Coordinates for d3d9wa_:

Click to download the PDB-style file with coordinates for d3d9wa_.
(The format of our PDB-style files is described here.)

Timeline for d3d9wa_: