| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
| Protein automated matches [190230] (23 species) not a true protein |
| Species Nocardia farcinica [TaxId:37329] [231965] (1 PDB entry) |
| Domain d3d9wa_: 3d9w A: [231966] automated match to d4guzd_ |
PDB Entry: 3d9w (more details), 2.7 Å
SCOPe Domain Sequences for d3d9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9wa_ d.3.1.0 (A:) automated matches {Nocardia farcinica [TaxId: 37329]}
pddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvr
ldlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallr
vttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfg
rdgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltlite
rpdgsadiraltpgelpevinelfdielpgpdldalttgswler
Timeline for d3d9wa_: