SCOPe 2.04: Domain d1byna_: 1byn A:

Lineage for d1byna_ (1byn A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d1byna_: 1byn A: [23193]
   first C2 domain
   complexed with ca

Details for d1byna_

PDB Entry: 1byn

PDB Description: solution structure of the calcium-bound first c2-domain of synaptotagmin i

PDB Compounds: (A:) protein (synaptotagmin I)

SCOPe Domain Sequences for d1byna_:

Sequence; same for both SEQRES and ATOM records:

>d1byna_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

Timeline for d1byna_:

• d1byna_ first appeared (with stable ids) in SCOP 1.55
  
• d1byna_ appears in SCOPe 2.03
  
• d1byna_ appears in SCOPe 2.05
  
• d1byna_ appears in the current release, SCOPe 2.08