Lineage for d1byna_ (1byn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772982Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2773010Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 2773025Domain d1byna_: 1byn A: [23193]
    first C2 domain
    complexed with ca

Details for d1byna_

PDB Entry: 1byn (more details)

PDB Description: solution structure of the calcium-bound first c2-domain of synaptotagmin i
PDB Compounds: (A:) protein (synaptotagmin I)

SCOPe Domain Sequences for d1byna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byna_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

SCOPe Domain Coordinates for d1byna_:

Click to download the PDB-style file with coordinates for d1byna_.
(The format of our PDB-style files is described here.)

Timeline for d1byna_: