Lineage for d1byna_ (1byn A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies) Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins) Protein Synaptogamin I [49576] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (3 PDB entries) 
Domain d1byna_: 1byn A: [23193]
Details for d1byna_
PDB Entry: 1byn (more details)
PDB Description: solution structure of the calcium-bound first c2-domain of synaptotagmin i
SCOP Domain Sequences for d1byna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byna_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus)}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek
SCOP Domain Coordinates for d1byna_:
Click to download the PDB-style file with coordinates for d1byna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1byna_:
- d1byna_ appears in SCOP 1.57
- d1byna_ appears in the current release, SCOPe 2.08
View in 3D