SCOPe 2.06: Domain d3crlc_: 3crl C:

Lineage for d3crlc_ (3crl C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)

8. Domain d3crlc_: 3crl C: [231904]
   Other proteins in same PDB: d3crla1, d3crla2, d3crlb1, d3crlb2
   automated match to d2q8ib_
   complexed with anp, k, mg

Details for d3crlc_

PDB Entry: 3crl, 2.61 Å

PDB Description: crystal structure of the pdhk2-l2 complex.

PDB Compounds: (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d3crlc_:

Sequence; same for both SEQRES and ATOM records:

>d3crlc_ b.84.1.1 (C:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadi

Timeline for d3crlc_:

• d3crlc_ first appeared in SCOPe 2.03
  
• d3crlc_ appears in SCOPe 2.05
  
• d3crlc_ appears in SCOPe 2.07
  
• d3crlc_ appears in the current release, SCOPe 2.08