SCOPe 2.06: Domain d3crlb1: 3crl B:12-177

Lineage for d3crlb1 (3crl B:12-177)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267826] (2 PDB entries)

8. Domain d3crlb1: 3crl B:12-177 [262278]
   Other proteins in same PDB: d3crla2, d3crlb2, d3crlc_, d3crld_
   automated match to d4mpca1
   complexed with anp, k, mg

Details for d3crlb1

PDB Entry: 3crl, 2.61 Å

PDB Description: crystal structure of the pdhk2-l2 complex.

PDB Compounds: (B:) Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d3crlb1:

Sequence; same for both SEQRES and ATOM records:

>d3crlb1 a.29.5.1 (B:12-177) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Timeline for d3crlb1:

• d3crlb1 first appeared in SCOPe 2.05
  
• d3crlb1 appears in SCOPe 2.07
  
• d3crlb1 appears in the current release, SCOPe 2.08