SCOPe 2.03: Domain d3ae4b2: 3ae4 B:115-247

Lineage for d3ae4b2 (3ae4 B:115-247)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (2 species)
   not a true protein

7. Species Sus scrofa [TaxId:9823] [230461] (2 PDB entries)

8. Domain d3ae4b2: 3ae4 B:115-247 [231788]
   Other proteins in same PDB: d3ae4b1
   automated match to d2bs2b1
   complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4

Details for d3ae4b2

PDB Entry: 3ae4, 2.91 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3ae4b2:

Sequence; same for both SEQRES and ATOM records:

>d3ae4b2 a.1.2.0 (B:115-247) automated matches {Sus scrofa [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

Timeline for d3ae4b2:

• d3ae4b2 is new in SCOPe 2.03-stable
  
• d3ae4b2 appears in SCOPe 2.04
  
• d3ae4b2 appears in the current release, SCOPe 2.08