PDB entry 3ae4

View 3ae4 on RCSB PDB site
Description: Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-methyl-benzamide
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: respiratory complex II, inhibitors, Electron transport, Iron, Iron-sulfur, Metal-binding, Mitochondrion, Mitochondrion inner membrane, Oxidoreductase, Transit peptide, Transport, Tricarboxylic acid cycle, Heme, Transmembrane, FAD-binding protein, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-02-04, released 2011-02-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.223
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q0QF01 (Start-621)
• Chain 'B':
  Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q007T0
  Domains in SCOPe 2.03: d3ae4b1, d3ae4b2
• Chain 'C':
  Compound: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0VWV4 (Start-139)
• Chain 'D':
  Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5GZW8 (Start-102)
• Heterogens: FAD, FES, SF4, F3S, MLI, HEM, EPH, N1M

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3ae4B (B:)
  aqtaaataprikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstlt
  frrscregicgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfya
  qyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylg
  pavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikk
  mmatykekkasa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ae4B (B:)
  prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
  icgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfyaqyksiepy
  lkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqay
  rwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikkmmatyke
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.