SCOPe 2.03: Domain d3ae4b1: 3ae4 B:9-114

Lineage for d3ae4b1 (3ae4 B:9-114)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (9 species)
   not a true protein

7. Species Sus scrofa [TaxId:9823] [230459] (2 PDB entries)

8. Domain d3ae4b1: 3ae4 B:9-114 [231787]
   Other proteins in same PDB: d3ae4b2
   automated match to d2bs2b2
   complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4

Details for d3ae4b1

PDB Entry: 3ae4, 2.91 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3ae4b1:

Sequence; same for both SEQRES and ATOM records:

>d3ae4b1 d.15.4.0 (B:9-114) automated matches {Sus scrofa [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd

Timeline for d3ae4b1:

• d3ae4b1 is new in SCOPe 2.03-stable
  
• d3ae4b1 appears in SCOPe 2.04
  
• d3ae4b1 appears in the current release, SCOPe 2.08