![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Succinate dehydogenase [81669] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries) |
![]() | Domain d3ae4b2: 3ae4 B:115-247 [231788] Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4a3, d3ae4b1, d3ae4c_, d3ae4d_ automated match to d2bs2b1 complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4 |
PDB Entry: 3ae4 (more details), 2.91 Å
SCOPe Domain Sequences for d3ae4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ae4b2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]} lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka iaeikkmmatyke
Timeline for d3ae4b2: