| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
| Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254758] (5 PDB entries) |
| Domain d3ae4b1: 3ae4 B:9-114 [231787] Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4a3, d3ae4b2, d3ae4c_, d3ae4d_ automated match to d2bs2b2 complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4 |
PDB Entry: 3ae4 (more details), 2.91 Å
SCOPe Domain Sequences for d3ae4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ae4b1 d.15.4.2 (B:9-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd
Timeline for d3ae4b1: