Class a: All alpha proteins [46456] (286 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Succinate dehydogenase [81708] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries) |
Domain d3ae4a3: 3ae4 A:446-622 [239097] Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4b1, d3ae4b2, d3ae4c_, d3ae4d_ automated match to d1zoya3 complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4 |
PDB Entry: 3ae4 (more details), 2.91 Å
SCOPe Domain Sequences for d3ae4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ae4a3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]} ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy
Timeline for d3ae4a3:
View in 3D Domains from other chains: (mouse over for more information) d3ae4b1, d3ae4b2, d3ae4c_, d3ae4d_ |