Lineage for d3ae4b1 (3ae4 B:9-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934092Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2934118Species Pig (Sus scrofa) [TaxId:9823] [254758] (5 PDB entries)
  8. 2934123Domain d3ae4b1: 3ae4 B:9-114 [231787]
    Other proteins in same PDB: d3ae4a1, d3ae4a2, d3ae4a3, d3ae4b2, d3ae4c_, d3ae4d_
    automated match to d2bs2b2
    complexed with eph, f3s, fad, fes, hem, mli, n1m, sf4

Details for d3ae4b1

PDB Entry: 3ae4 (more details), 2.91 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3ae4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ae4b1 d.15.4.2 (B:9-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd

SCOPe Domain Coordinates for d3ae4b1:

Click to download the PDB-style file with coordinates for d3ae4b1.
(The format of our PDB-style files is described here.)

Timeline for d3ae4b1: